Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
IFNT1; Interferon tau-1; IFN-tau-1; Antiluteolysin; Trophoblast antiluteolytic protein; Trophoblast protein 1; TP-1; Trophoblastin
Species
Bos taurus (Bovine)
Expression Region
24-195aa
Target Protein Sequence
CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Bovine MIF protein began at the genetic level, where the coding sequence for the MIF protein was first isolated and cloned into an expression plasmid vector. Recombinant DNA technology was used in the process. Next step was cloning. The expression vector must be introduced into the host cell (Yeast) so that the cells could be cultured and expressed the desired IFNT1 protein. And we finally got the recombinant IFNT1 protein with the purity of 90%+ determined by SDS-PAGE.
IFNT1 is a novel type of I interferon. Trophoblasts of ruminant species secrete multiple forms of IFNT1. IFNT1 is structurally related to IFN-a and IFN-β. IFNT1 are currently found only in ruminant ungulate species. There are at least three to four functional IFNT1 genes in cattle and sheep. The proteins are produced in large quantities by the trophoblast during the period of conceptus elongation that occurs just prior to initiation of implantation. Exposure of the uterus to IFNT1 appears to reduce the pulsatile release of prostaglandin. Despite this involvement in recue of the corpus luteum of pregnancy, the IFNT1 display the typical biological properties of other type I IFN. IFNT1 constitute a serologically distinct group and differ considerably in amino acid sequence from other type I IFN. Additionally, IFNT1 gene expression is poorly induced by virus. More importantly, evidence is accumulating that IFNT1 may be considerably more potent in their ability to extend inter-estrous intervals than other type I IFN in no pregnant ewes..